PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA11G00017
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family NAC
Protein Properties Length: 295aa    MW: 33572.5 Da    PI: 6.6805
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA11G00017genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.83.5e-52141391128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                 lppGfrF Ptdeel+v+yL+++v+g +++l +vi e+d+yk++PwdLp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk +++ +g+ 
  AA11G00017  14 LPPGFRFFPTDEELLVQYLCRQVAGYHFSL-QVIGEIDLYKFDPWDLPNKALFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIITA-EGQR 110
                 79***************************9.99***************8888899***********************************9999.999* PP

         NAM 100 vglkktLvfykgrapkgektdWvmheyrl 128
                 vg+kk+Lvfy+g+apkg+kt+W+mheyrl
  AA11G00017 111 VGIKKSLVFYTGKAPKGTKTNWIMHEYRL 139
                 ***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.45E-659163IPR003441NAC domain
PROSITE profilePS5100560.07114163IPR003441NAC domain
PfamPF023652.7E-2515139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MGVAEKDPLA QLSLPPGFRF FPTDEELLVQ YLCRQVAGYH FSLQVIGEID LYKFDPWDLP  60
NKALFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKIITAEGQR VGIKKSLVFY  120
TGKAPKGTKT NWIMHEYRLI EHSPRRQGSS KLDDWVLCRI YKKSSGSAQR QQQQQQQQEA  180
PIHDFNDEYS VNEPSSCSSS HDDVFDSFPK IEDQSFNLPR MNSLRTILNG NFDWASLAGL  240
NPVSDLAPMN DLSYGGDESM RLKNQRNSGE LTQSLGLDFI DFGLPGQNNG FGYRQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-10611707174NAC domain-containing protein 19
3swm_B1e-10611707174NAC domain-containing protein 19
3swm_C1e-10611707174NAC domain-containing protein 19
3swm_D1e-10611707174NAC domain-containing protein 19
3swp_A1e-10611707174NAC domain-containing protein 19
3swp_B1e-10611707174NAC domain-containing protein 19
3swp_C1e-10611707174NAC domain-containing protein 19
3swp_D1e-10611707174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010438620.11e-155PREDICTED: NAC domain-containing protein 72-like
SwissprotQ93VY31e-156NAC72_ARATH; NAC domain-containing protein 72
TrEMBLR0F5N81e-152R0F5N8_9BRAS; Uncharacterized protein
STRINGAT4G27410.31e-149(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14352795
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.21e-155NAC family protein